Multi-symplectic wavelet collocation method for Maxwell's equations

DOI10.4208/AAMM.11-M1183MaRDI QIDQ4919295zbMATH OpenOpenAlexFDO

Authors Hua-Jun Zhu, Song-He Song, Ya-Ming Chen

Publication date 8 May 2013

Published in Advances in Applied Mathematics and Mechanics (Search for Journal in Brave)

Full work available at URL https://doi.org/10.4208/aamm.11-m1183

zbMATH Keywords

conservation lawsMaxwell's equationsmulti-symplecticsymplecticwavelet collocation method

Mathematics Subject Classification ID

Discretization methods and integrators (symplectic, variational, geometric, etc.) for dynamical systems (37M15) Spectral, collocation and related methods for initial value and initial-boundary value problems involving PDEs (65M70) Numerical methods for Hamiltonian systems including symplectic integrators (65P10) Numerical methods for wavelets (65T60)

Recommendations

• An energy-preserving wavelet collocation method for general multi-symplectic formulations of Hamiltonian PDEs
• Multi-symplectic wavelet collocation method for the nonlinear Schrödinger equation and the Camassa-Holm equation
• Numerical dispersion analysis of a multi-symplectic scheme for the three dimensional Maxwell's equations
• Energy evolution of multi-symplectic methods for Maxwell equations with perfectly matched layer boundary
• Symplectic and multi-symplectic wavelet collocation methods for two-dimensional Schrödinger equations

Cited in

(22)

• Convergence of time-splitting energy-conserved symplectic schemes for 3D Maxwell's equations
• An energy-conserving method for stochastic Maxwell equations with multiplicative noise
• Interpolating wavelet collocation method of time dependent Maxwell's equations: Characterization of electrically large optical waveguide discontinuities.
• Linearly implicit local energy-preserving algorithm for a class of multi-symplectic Hamiltonian PDEs
• Optimal error estimate for energy-preserving splitting schemes for Maxwell's equations
• Wavelets for the Maxwell's equations: an overview
• An exploration of multiresolution symplectic scheme for wave propagation using second-generation wavelets
• Numerical dispersion analysis of a multi-symplectic scheme for the three dimensional Maxwell's equations
• Energy evolution of multi-symplectic methods for Maxwell equations with perfectly matched layer boundary
• Numerical analysis of AVF methods for three-dimensional time-domain Maxwell's equations
• Numerical analysis of a multi-symplectic scheme for the time-domain Maxwell's equations
• Two energy-conserved splitting methods for three-dimensional time-domain Maxwell's equations and the convergence analysis
• Structure-preserving wavelet algorithms for the nonlinear Dirac model
• A conformal energy-conserved method for Maxwell's equations with perfectly matched layers
• Multi-symplectic wavelet collocation method for the nonlinear Schrödinger equation and the Camassa-Holm equation
• A novel class of explicit divergence-free time-domain methods for efficiently solving Maxwell's equations
• Symplectic and multi-symplectic wavelet collocation methods for two-dimensional Schrödinger equations
• Symplectic and multisymplectic numerical methods for Maxwell's equations
• An exact in time Fourier pseudospectral method with multiple conservation laws for three-dimensional Maxwell's equations
• A novel structure-preserving scheme for three-dimensional Maxwell's equations
• A newly modified method for 3D Maxwell's equation
• Splitting multisymplectic integrators for Maxwell's equations

This page was built for publication: Multi-symplectic wavelet collocation method for Maxwell's equations

Report a bug (only for logged in users!)Click here to report a bug for this page (MaRDI item Q4919295)