A textbook of graph theory
From MaRDI portal
Publication:5917970
zbMATH Open0938.05001MaRDI QIDQ5917970FDOQ5917970
Authors:
Publication date: 6 February 2000
Published in: Universitext (Search for Journal in Brave)
Recommendations
treesinterval graphscharacterizationconnectivityplanar graphstextbooktournamentscoloringsmatchingsplanarityclaw-free graphsHamiltonian graphsindependent setsEulerian graphstriangulated graphsintroductory textHamiltonian line-graph
Introductory exposition (textbooks, tutorial papers, etc.) pertaining to combinatorics (05-01) Graph theory (05Cxx)
Cited In (only showing first 100 items - show all)
- When is the complement of the zero-divisor graph of a commutative ring planar?
- On computing the Hamiltonian index of graphs
- Zagreb indices and coindices of product graphs
- Remark on subgroup intersection graph of finite abelian groups
- Handbook of graph theory
- Cyclic orthogonal double covers of 4-regular circulant graphs
- The exact zero-divisor graph of a reduced ring
- A STUDY ON EQUITABLE CHROMATIC AND THRESHOLD OF MYCIELSKIAN OF GRAPHS
- Directed Hamilton cycle decompositions of the tensor products of symmetric digraphs
- Hamilton cycle decompositions of the tensor products of complete bipartite graphs and complete multipartite graphs
- Some results on the complement of the comaximal ideal graphs of commutative rings
- Hamilton cycle decompositions of the tensor product of complete multipartite graphs
- Decomposing graphs into internally-disjoint induced paths
- On the clique number of the complement of the annihilating ideal graph of a commutative ring
- Title not available (Why is that?)
- Some results on the comaximal ideal graph of a commutative ring
- When is the complement of the comaximal graph of a commutative ring planar?
- Two-fold factorization of the complete bipartite graphs by infinite graph classes
- Some properties of the complement of the zero-divisor graph of a commutative ring
- When is the complement of the zero-divisor graph of a commutative ring complemented?
- On Hamiltonian decompositions of tensor products of graphs
- A first course in graph theory and combinatorics
- Construction of L-equienergetic graphs using some graph operations
- Construction of L-Borderenergetic Graphs
- 2-quasitotal fuzzy graphs and their total coloring
- Basic graph theory
- Some new results on energy of graphs with self loops
- Dichromatic polynomial of product digraphs
- The first and the second Zagreb indices of the generalized Mycielskian of graphs
- Non‐linear co‐ordinated path following control of multiple wheeled robots with bidirectional communication constraints
- \(C_{4p}\)-frame of complete multipartite multigraphs
- Cartesian product of two symmetric starter vectors of orthogonal double covers
- Dissecting a square into congruent polygons
- On some topological indices of the tensor products of graphs
- The energy of a graph
- Closed trail decompositions of some classes of regular graphs
- Title not available (Why is that?)
- When is the annihilating ideal graph of a zero-dimensional semiquasilocal commutative ring planar? Nonquasilocal case
- Wiener index of graphs with more than one cut-vertex
- Connectivity of the generalised Mycielskian of digraphs
- Line graphs and line digraphs
- On the planarity of a graph associated to a commutative ring and on the planarity of its complement
- Greedy heuristics for the diameter-constrained minimum spanning tree problem
- \(T\)-coloring of product graphs
- The theory of graphs. Translated from the 1958 French edition by Alison Doig.
- Improved approximability and non-approximability results for graph diameter decreasing problems
- Link-based multi-class hazmat routing-scheduling problem: a multiple demon approach
- Maximum degree and minimum degree spectral radii of some graph operations
- On the complement of a graph associated with the set of all nonzero annihilating ideals of a commutative ring
- On equienergetic, hyperenergetic and hypoenergetic graphs
- Annihilating-ideal graphs with independence number at most four
- Double Roman domination number
- A note on a graph related to the comaximal ideal graph of a commutative ring
- Adventures in graph theory
- Theory and Application of Graphs
- Complement of the generalized total graph of commutative rings
- Augmented nodal matrices and normal trees
- The exact annihilating-ideal graph of a commutative ring
- Resolvable even cycle decompositions of the tensor product of complete graphs
- Characterization of total very excellent trees
- Topological theory of graphs
- Number of spanning trees of different products of complete and complete bipartite graphs
- Connectivity of the Mycielskian of a graph
- Hamiltonian trace graph of matrices
- On subgroup regular sets in Cayley sum graphs
- The Gallai and anti-Gallai graphs of strongly regular graphs
- Recent advancements in graph theory
- SOME RESULTS ON THE COMPLEMENT OF THE INTERSECTION GRAPH OF SUBGROUPS OF A FINITE GROUP
- Betti numbers of graphs with an application to anomaly detection
- Even vertex odd mean labeling of some cycle related graphs
- Title not available (Why is that?)
- Some results on a spanning subgraph of the complement of the annihilating-ideal graph of a commutative reduced ring
- Complement of the Generalized Total Graph of Commutative Rings – A Survey
- Space-filling curves of self-similar sets (II): edge-to-trail substitution rule
- On co-complete \(k\)-partite graph valued functions
- Induced dominating sequence and ESD graphs
- Some properties of super-graph of \((\mathscr{C}(R))^c\) and its line graph
- Equitable critical graphs
- Topology automaton of self-similar sets and its applications to metrical classifications
- Some remarks on \((\mathrm{INC}(R))^c\)
- On the complement of the total zero-divisor graph of a commutative ring
- Quantum multiplicative graph and a type of separate clique number
- Domination number in the annihilating-submodule graph of modules over commutative rings
- On spectrum of a graph given by color Harary matrix
- Chromatic number of some families of graphs
- Space-filling curves of self-similar sets. III: Skeletons
- Results on uniquely colorable digraphs
- Title not available (Why is that?)
- Hub Zagreb energy of graphs
- Planarity of a spanning subgraph of the intersection graph of ideals of a commutative ring I. Nonquasilocal case
- Planarity of a spanning subgraph of the intersection graph of ideals of a commutative ring. II: Quasilocal case
- Wiener index of the tensor product of cycles
- On a spanning subgraph of the annihilating-ideal graph of a commutative ring
- Some new results on Seidel equienergetic graphs
- Weighted Szeged indices of some graph operations
- When the maximal graph is planar, outerplanar, and ring graph
- Some results on a supergraph of the comaximal ideal graph of a commutative ring
- Doubling properties of self-similar measures and Bernoulli measures on self-affine Sierpiński sponges
- Complement of the generalized total graph of fields
- A tour through graph theory
This page was built for publication: A textbook of graph theory
Report a bug (only for logged in users!)Click here to report a bug for this page (MaRDI item Q5917970)